PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010912370.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family Nin-like
Protein Properties Length: 974aa    MW: 107291 Da    PI: 6.9886
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010912370.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.43.2e-29608659152
          RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                     aek+isle+l++yFs+++kdAAk+Lgvc+T++KriCRq+GI+RWP+Rki+++
  XP_010912370.1 608 AEKSISLEVLQQYFSGSLKDAAKSLGVCPTTMKRICRQHGISRWPSRKISKV 659
                     589**********************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.7598679IPR003035RWP-RK domain
PfamPF020423.2E-26612659IPR003035RWP-RK domain
SuperFamilySSF542771.6E-22872965No hitNo description
SMARTSM006661.8E-21879961IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2405.6E-24879961No hitNo description
PROSITE profilePS5174516.06879961IPR000270PB1 domain
CDDcd064072.56E-33880960No hitNo description
PfamPF005648.2E-14880960IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0010118Biological Processstomatal movement
GO:0010167Biological Processresponse to nitrate
GO:0042128Biological Processnitrate assimilation
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 974 aa     Download sequence    Send to blast
MESPPFIPVA SCPPLXSPSS HVGNRRREAA RRRLDSPRPG AHGPRSRHRR LHLALRSQRL  60
RLHSSLLFPS LLLLLPSPWP PSAFLPPSPS PIWIVEDRAA EISSFLEDCP RFLNANEGAR  120
CGNVNASNSK ARRLPLPAVE ENADDSRVIK ERMTQALRHF KESTDQHVLV QVWAPMKKGD  180
RCFLTTSGQP FVLDPQSTRL LQYRTVSVMY IFSVDEDGEG SLGLPGRVYR HRLPEWTPNV  240
QYYSSKEYPR LAHALNYNVQ GSLALPVFEP SGQSCVGVVE LVMTLPKINY AREVDKVCKA  300
LQAVNLKSSE ILDHPNIQIS NEGRQEALAE ILEVLTVVCE AQKLPLAQTW VPCKRRTILA  360
HGGGLKKICS SFDGSCMGQV CMSTTDVAFY VIDAHMWGFR EACVEHHLQI GQGVAGRAFA  420
LRKPCFAEDV TKFSKSEYPL VHYARMFGLV GCLAICLQST HSGDDDYILE FFLPHDCKYL  480
IEQQALLDSI SALMKQCFRS LKVVSDLELQ KGISFEIINM FANENHGFEP KHICNQICDS  540
HLYASPETYT LEGYDDSQNE GNVTSDSRVQ HFPTHANAEK ASNIHFDSAG SLLSNRNNGA  600
PEKRRGKAEK SISLEVLQQY FSGSLKDAAK SLGVCPTTMK RICRQHGISR WPSRKISKVN  660
RSLSKLKRVI ESVQVAEGAF HLTSLGCPLP VAVGSISWPV NLDGSKEITG AVKDNVSSPH  720
KTPGKNDQHD KLLAQQELGH DDSSPMPEPG KDSPCSKTNG SSEGSMDTPA SLGSFHESPV  780
NETFLDDASP PSDLKQGIVG DSLEFTLQHA GGPRLPPVCL MPGVNVAKPQ PQLAGMLIED  840
SGSSKDLKNL CSNARDGCQD EHVMAANPLN PMAMPETRMV TIKASHQEDI IRFRLACTAG  900
IVALRDEVTK RLKLEVGTFD IKYLDDDHEW VMLACNADLE ECIEISGLSG SHVIRLAVHD  960
VTTHLGSSCA SLGD
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00449DAPTransfer from AT4G24020Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010912370.10.0PREDICTED: LOW QUALITY PROTEIN: protein NLP3-like
SwissprotQ5NB820.0NLP3_ORYSJ; Protein NLP3
TrEMBLM0SHP00.0M0SHP0_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr3P25240_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47783660
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.10.0NIN like protein 7